Lineage for d5ovoa_ (5ovo A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736587Fold a.209: ADP-ribosylglycohydrolase [101477] (1 superfamily)
    multihelical; bundle
  4. 2736588Superfamily a.209.1: ADP-ribosylglycohydrolase [101478] (2 families) (S)
  5. 2736593Family a.209.1.0: automated matches [191592] (1 protein)
    not a true family
  6. 2736594Protein automated matches [191071] (2 species)
    not a true protein
  7. 2736595Species Azospirillum brasilense [TaxId:192] [188978] (3 PDB entries)
  8. 2736597Domain d5ovoa_: 5ovo A: [340045]
    Other proteins in same PDB: d5ovob_
    automated match to d3o5ta_
    complexed with adp, mg, mn

Details for d5ovoa_

PDB Entry: 5ovo (more details), 1.55 Å

PDB Description: structure of drag-glnz-delta42-54 complex from azospirillum brasilense
PDB Compounds: (A:) ADP-ribosyl-(Dinitrogen reductase) hydrolase

SCOPe Domain Sequences for d5ovoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ovoa_ a.209.1.0 (A:) automated matches {Azospirillum brasilense [TaxId: 192]}
dhsirsralgaylglacgdalgatvefltkgeiahqygvhkhikgggwlklpagqvtddt
emsihlgrailaapewdarraaeefavwlkgvpvdvgdttrrgirrfimhgtlsepesey
hagngaamrnlpvalatlgddaaferwtveqahithcnamsdaatltlghmvrrlvlggd
vrdvrdesnkliakhrqfkfqpyrglatayivdtmqtvmhyyfqtdsvescvvetvnqgg
dadttgaiagmlagatygvetipprwlrkldrdvyneicaqvdgllarapalkqg

SCOPe Domain Coordinates for d5ovoa_:

Click to download the PDB-style file with coordinates for d5ovoa_.
(The format of our PDB-style files is described here.)

Timeline for d5ovoa_: