SCOPe 2.05: Domain d1fbta_: 1fbt A:

Lineage for d1fbta_ (1fbt A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.4: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53267] (1 protein)

6. Protein 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53268] (2 species)
   bifunctional enzyme

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [53269] (8 PDB entries)

8. Domain d1fbta_: 1fbt A: [34004]
   complexed with po4

Details for d1fbta_

PDB Entry: 1fbt, 2 Å

PDB Description: the bisphosphatase domain of the bifunctional rat liver 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase

PDB Compounds: (A:) fructose-2,6-bisphosphatase

SCOPe Domain Sequences for d1fbta_:

Sequence; same for both SEQRES and ATOM records:

>d1fbta_ c.60.1.4 (A:) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rsiylcrhgeselnlrgriggdsglsargkqyayalanfirsqgisslkvwtshmkrtiq
taealgvpyeqwkalneidagvceemtyeeiqehypeefalrdqdkyryrypkgesyedl
vqrlepvimelerqenvlvichqavmrcllayfldkssdelpylkcplhtvlkltpvayg
crvesiylnv

Timeline for d1fbta_:

• d1fbta_ first appeared (with stable ids) in SCOP 1.55
  
• d1fbta_ appears in SCOPe 2.04
  
• d1fbta_ appears in SCOPe 2.06
  
• d1fbta_ appears in the current release, SCOPe 2.08