Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) |
Family c.60.1.4: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53267] (1 protein) |
Protein 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53268] (2 species) bifunctional enzyme |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [53269] (8 PDB entries) |
Domain d1fbta_: 1fbt A: [34004] complexed with po4 |
PDB Entry: 1fbt (more details), 2 Å
SCOPe Domain Sequences for d1fbta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fbta_ c.60.1.4 (A:) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} rsiylcrhgeselnlrgriggdsglsargkqyayalanfirsqgisslkvwtshmkrtiq taealgvpyeqwkalneidagvceemtyeeiqehypeefalrdqdkyryrypkgesyedl vqrlepvimelerqenvlvichqavmrcllayfldkssdelpylkcplhtvlkltpvayg crvesiylnv
Timeline for d1fbta_: