SCOPe 2.06: Domain d5o74h_: 5o74 H:

Lineage for d5o74h_ (5o74 H:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (179 PDB entries)

8. Domain d5o74h_: 5o74 H: [340037]
   automated match to d3l0ib_
   complexed with gdp

Details for d5o74h_

PDB Entry: 5o74, 2.5 Å

PDB Description: crystal structure of human rab1b covalently bound to the gef domain of drra/sidm from legionella pneumophila in the presence of gdp

PDB Compounds: (H:) Ras-related protein Rab-1B

SCOPe Domain Sequences for d5o74h_:

Sequence; same for both SEQRES and ATOM records:

>d5o74h_ c.37.1.8 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiwd
tagqerfrtitssyyxgahgiivvydvtdqesyanvkqwlqeidryasenvnkllvgnks
dlttkkvvdnttakefadslgipfletsaknatnveqafmtmaaeikkrm

Timeline for d5o74h_:

• d5o74h_ is new in SCOPe 2.06-stable
  
• d5o74h_ appears in SCOPe 2.07
  
• d5o74h_ appears in the current release, SCOPe 2.08