SCOP 1.59: Domain d1bif_2: 1bif 250-468

Lineage for d1bif_2 (1bif 250-468)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.4: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53267] (1 protein)

6. Protein 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53268] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [53269] (5 PDB entries)

8. Domain d1bif_2: 1bif 250-468 [34003]
   Other proteins in same PDB: d1bif_1

Details for d1bif_2

PDB Entry: 1bif, 2 Å

PDB Description: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase bifunctional enzyme complexed with atp-g-s and phosphate

SCOP Domain Sequences for d1bif_2:

Sequence; same for both SEQRES and ATOM records:

>d1bif_2 c.60.1.4 (250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus)}
siylcrhgeselnlkgriggdpglsprgrefskhlaqfisdqnikdlkvftsqmkrtiqt
aealsvpyeqfkvlneidagvceemtyeeiqdhyplefalrdqdkyryrypkgesyedlv
qrlepvimelerqenvlvichqavmrcllayfldkaaeelpylkcplhtvlkltpvaygc
kvesiflnvaavnthrdrpqnvdisrpseealvtvpahq

Timeline for d1bif_2:

• d1bif_2 first appeared (with stable ids) in SCOP 1.55
  
• d1bif_2 appears in SCOP 1.57
  
• d1bif_2 appears in SCOP 1.61
  
• d1bif_2 appears in the current release, SCOPe 2.08, called d1bifa2