SCOPe 2.07: Domain d5j2sa_: 5j2s A:

Lineage for d5j2sa_ (5j2s A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (20 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [339984] (1 PDB entry)

8. Domain d5j2sa_: 5j2s A: [340024]
   automated match to d2mtia_
   complexed with bma, nag

Details for d5j2sa_

PDB Entry: 5j2s, 2 Å

PDB Description: nkr-p1b from rattus norvegicus

PDB Compounds: (A:) Killer cell lectin-like receptor subfamily B member 1B allele A

SCOPe Domain Sequences for d5j2sa_:

Sequence; same for both SEQRES and ATOM records:

>d5j2sa_ d.169.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kcpkdwhshqdkcfhvsqtsitwkgsladcggkgatlllvqdqeelrflrnltkrisssf
wiglsytlsdekwkwingstlnsdalnitgdtekdscasvsqdkvlsescdsdniwicqx
el

Timeline for d5j2sa_:

• d5j2sa_ first appeared in SCOPe 2.06
  
• d5j2sa_ appears in the current release, SCOPe 2.08