Lineage for d5h0ba3 (5h0b A:250-531)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981671Protein Haemopoetic cell kinase Hck [56151] (1 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 2981672Species Human (Homo sapiens) [TaxId:9606] [56152] (25 PDB entries)
  8. 2981673Domain d5h0ba3: 5h0b A:250-531 [340019]
    Other proteins in same PDB: d5h0ba1, d5h0ba2, d5h0ba4
    automated match to d1qcfa3
    complexed with ooq

Details for d5h0ba3

PDB Entry: 5h0b (more details), 1.65 Å

PDB Description: crystal structure of hck complexed with a pyrrolo-pyrimidine inhibitor (s)-2-(((1r,4s)-4-(4-amino-5-(4-phenoxyphenyl)-7h-pyrrolo[2,3- d]pyrimidin-7-yl)cyclohexyl)amino)-4-methylpentanoic acid
PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d5h0ba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h0ba3 d.144.1.7 (A:250-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwt
apeainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpe
elynimmrcwknrpeerptfeyiqsvlddfytatesqyeeip

SCOPe Domain Coordinates for d5h0ba3:

Click to download the PDB-style file with coordinates for d5h0ba3.
(The format of our PDB-style files is described here.)

Timeline for d5h0ba3: