SCOPe 2.06: Domain d6b2ad_: 6b2a D:

Lineage for d6b2ad_ (6b2a D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (54 PDB entries)

8. Domain d6b2ad_: 6b2a D: [340014]
   automated match to d5a43c_
   complexed with dmu, f, na; mutant

Details for d6b2ad_

PDB Entry: 6b2a, 2.65 Å

PDB Description: crystal structure of fluoride channel fluc ec2 f80m mutant

PDB Compounds: (D:) monobody

SCOPe Domain Sequences for d6b2ad_:

Sequence; same for both SEQRES and ATOM records:

>d6b2ad_ b.1.2.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svssvptklevvaatptslliswdapavtvvhyvitygetggnspvqeftvpgskstati
sglkpgvdytitvytmyysysdlysysspisinyrt

Timeline for d6b2ad_:

• d6b2ad_ is new in SCOPe 2.06-stable
  
• d6b2ad_ appears in SCOPe 2.07
  
• d6b2ad_ appears in the current release, SCOPe 2.08