Lineage for d5kd4a1 (5kd4 A:2-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2938064Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (23 PDB entries)
  8. 2938105Domain d5kd4a1: 5kd4 A:2-181 [340008]
    Other proteins in same PDB: d5kd4a2, d5kd4b_, d5kd4c2, d5kd4d_
    automated match to d1qo3a2

Details for d5kd4a1

PDB Entry: 5kd4 (more details), 3.05 Å

PDB Description: crystal structure of murine mhc-i h-2dd in complex with murine beta2- microglobulin and a variant of peptide (pvi10) of hiv gp120 mn isolate (igpgrafyvi)
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-D alpha chain

SCOPe Domain Sequences for d5kd4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kd4a1 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
shslryfvtavsrpgfgeprymevgyvdntefvrfdsdaenpryeprarwieqegpeywe
retrrakgneqsfrvdlrtalryynqsaggshtlqwmagcdvesdgrllrgywqfaydgc
dyialnedlktwtaadmaaqitrrkweqagaaerdraylegecvewlrrylkngnatllr

SCOPe Domain Coordinates for d5kd4a1:

Click to download the PDB-style file with coordinates for d5kd4a1.
(The format of our PDB-style files is described here.)

Timeline for d5kd4a1: