![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
![]() | Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (23 PDB entries) |
![]() | Domain d5kd4a1: 5kd4 A:2-181 [340008] Other proteins in same PDB: d5kd4a2, d5kd4b_, d5kd4c2, d5kd4d_ automated match to d1qo3a2 |
PDB Entry: 5kd4 (more details), 3.05 Å
SCOPe Domain Sequences for d5kd4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kd4a1 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]} shslryfvtavsrpgfgeprymevgyvdntefvrfdsdaenpryeprarwieqegpeywe retrrakgneqsfrvdlrtalryynqsaggshtlqwmagcdvesdgrllrgywqfaydgc dyialnedlktwtaadmaaqitrrkweqagaaerdraylegecvewlrrylkngnatllr
Timeline for d5kd4a1:
![]() Domains from other chains: (mouse over for more information) d5kd4b_, d5kd4c1, d5kd4c2, d5kd4d_ |