Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries) Uniprot P01887 |
Domain d5kd7j1: 5kd7 J:1-99 [340003] Other proteins in same PDB: d5kd7a1, d5kd7a2, d5kd7c1, d5kd7c2, d5kd7d2, d5kd7f1, d5kd7f2, d5kd7g2, d5kd7i1, d5kd7i2, d5kd7j2 automated match to d1kjvb_ complexed with edo, gol |
PDB Entry: 5kd7 (more details), 2.35 Å
SCOPe Domain Sequences for d5kd7j1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kd7j1 b.1.1.2 (J:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhasmaepktvywdrdm
Timeline for d5kd7j1: