Lineage for d5kd7a1 (5kd7 A:2-181)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2182691Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2183074Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (23 PDB entries)
  8. 2183108Domain d5kd7a1: 5kd7 A:2-181 [339999]
    Other proteins in same PDB: d5kd7a2, d5kd7b_, d5kd7c2, d5kd7d1, d5kd7d2, d5kd7f2, d5kd7g1, d5kd7g2, d5kd7i2, d5kd7j1, d5kd7j2
    automated match to d1qo3a2
    complexed with edo, gol

Details for d5kd7a1

PDB Entry: 5kd7 (more details), 2.35 Å

PDB Description: crystal structure of murine mhc-i h-2dd in complex with murine beta2- microglobulin and a variant of peptide (pv9) of hiv gp120 mn isolate (igpgrafyv)
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-D alpha chain

SCOPe Domain Sequences for d5kd7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kd7a1 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
shslryfvtavsrpgfgeprymevgyvdntefvrfdsdaenpryeprarwieqegpeywe
retrrakgneqsfrvdlrtalryynqsaggshtlqwmagcdvesdgrllrgywqfaydgc
dyialnedlktwtaadmaaqitrrkweqagaaerdraylegecvewlrrylkngnatllr

SCOPe Domain Coordinates for d5kd7a1:

Click to download the PDB-style file with coordinates for d5kd7a1.
(The format of our PDB-style files is described here.)

Timeline for d5kd7a1: