Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88606] (111 PDB entries) Uniprot P01901 22-299 |
Domain d5kd7i2: 5kd7 I:182-275 [339995] Other proteins in same PDB: d5kd7a1, d5kd7b_, d5kd7c1, d5kd7d1, d5kd7d2, d5kd7f1, d5kd7g1, d5kd7g2, d5kd7i1, d5kd7j1, d5kd7j2 automated match to d1qo3a1 complexed with edo, gol |
PDB Entry: 5kd7 (more details), 2.35 Å
SCOPe Domain Sequences for d5kd7i2:
Sequence, based on SEQRES records: (download)
>d5kd7i2 b.1.1.2 (I:182-275) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdppkahvthhrrpegdvtlrcwalgfypaditltwqlngeeltqemelvetrpagdgtf qkwasvvvplgkeqkytchveheglpepltlrwg
>d5kd7i2 b.1.1.2 (I:182-275) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdppkahvthhrrgdvtlrcwalgfypaditltwqlngeeltqemelvetrpagdgtfqk wasvvvplgkeqkytchveheltlrwg
Timeline for d5kd7i2: