![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
![]() | Protein automated matches [190159] (19 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [339984] (1 PDB entry) |
![]() | Domain d5j2sb_: 5j2s B: [339985] automated match to d2mtia_ complexed with bma, nag |
PDB Entry: 5j2s (more details), 2 Å
SCOPe Domain Sequences for d5j2sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j2sb_ d.169.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} kcpkdwhshqdkcfhvsqtsitwkgsladcggkgatlllvqdqeelrflrnltkrisssf wiglsytlsdekwkwingstlnsdalnitgdtekdscasvsqdkvlsescdsdniwicqx el
Timeline for d5j2sb_: