Lineage for d5j2sb_ (5j2s B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (19 species)
    not a true protein
  7. 2560025Species Norway rat (Rattus norvegicus) [TaxId:10116] [339984] (1 PDB entry)
  8. 2560027Domain d5j2sb_: 5j2s B: [339985]
    automated match to d2mtia_
    complexed with bma, nag

Details for d5j2sb_

PDB Entry: 5j2s (more details), 2 Å

PDB Description: nkr-p1b from rattus norvegicus
PDB Compounds: (B:) Killer cell lectin-like receptor subfamily B member 1B allele A

SCOPe Domain Sequences for d5j2sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j2sb_ d.169.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kcpkdwhshqdkcfhvsqtsitwkgsladcggkgatlllvqdqeelrflrnltkrisssf
wiglsytlsdekwkwingstlnsdalnitgdtekdscasvsqdkvlsescdsdniwicqx
el

SCOPe Domain Coordinates for d5j2sb_:

Click to download the PDB-style file with coordinates for d5j2sb_.
(The format of our PDB-style files is described here.)

Timeline for d5j2sb_: