Lineage for d5h22a_ (5h22 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212981Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2212982Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2212983Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2213185Protein automated matches [190229] (11 species)
    not a true protein
  7. 2213375Species Mus musculus [TaxId:10090] [339980] (1 PDB entry)
  8. 2213376Domain d5h22a_: 5h22 A: [339981]
    automated match to d4egia_
    complexed with 7ft

Details for d5h22a_

PDB Entry: 5h22 (more details), 1.5 Å

PDB Description: hsp90 alpha n-terminal domain in complex with an inhibitor
PDB Compounds: (A:) HSP90AA1 protein

SCOPe Domain Sequences for d5h22a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h22a_ d.122.1.1 (A:) automated matches {Mus musculus [TaxId: 10090]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipskqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfvek

SCOPe Domain Coordinates for d5h22a_:

Click to download the PDB-style file with coordinates for d5h22a_.
(The format of our PDB-style files is described here.)

Timeline for d5h22a_: