SCOPe 2.08: Domain d6b2bd_: 6b2b D:

Lineage for d6b2bd_ (6b2b D:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)

8. Domain d6b2bd_: 6b2b D: [339971]
   automated match to d5a43c_
   complexed with dmu, f, na; mutant

Details for d6b2bd_

PDB Entry: 6b2b, 2.6 Å

PDB Description: crystal structure of fluoride channel fluc ec2 f83m mutant

PDB Compounds: (D:) monobody

SCOPe Domain Sequences for d6b2bd_:

Sequence; same for both SEQRES and ATOM records:

>d6b2bd_ b.1.2.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svssvptklevvaatptslliswdapavtvvhyvitygetggnspvqeftvpgskstati
sglkpgvdytitvytmyysysdlysysspisinyrt

Timeline for d6b2bd_:

• d6b2bd_ first appeared in SCOPe 2.06
  
• d6b2bd_ appears in SCOPe 2.07