Lineage for d1dklb_ (1dkl B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2127984Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2127985Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2128137Family c.60.1.2: Histidine acid phosphatase [53258] (4 protein domains)
  6. 2128142Protein Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) [53263] (4 species)
  7. 2128158Species Escherichia coli [TaxId:562] [53266] (6 PDB entries)
  8. 2128160Domain d1dklb_: 1dkl B: [33997]

Details for d1dklb_

PDB Entry: 1dkl (more details), 2.3 Å

PDB Description: crystal structure of escherichia coli phytase at ph 4.5 (no ligand bound)
PDB Compounds: (B:) phytase

SCOPe Domain Sequences for d1dklb_:

Sequence, based on SEQRES records: (download)

>d1dklb_ c.60.1.2 (B:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Escherichia coli [TaxId: 562]}
pelklesvvivsrhgvraptkatqlmqdvtpdawptwpvklgwltprggeliaylghyqr
qrlvadgllakkgcpqsgqvaiiadvdertrktgeafaaglapdcaitvhtqadtsspdp
lfnplktgvcqldnanvtdailsraggsiadftghrqtafrelervlnfpqsnlclkrek
qdescsltqalpselkvsadnvsltgavslasmlteifllqqaqgmpepgwgritdshqw
ntllslhnaqfyllqrtpevarsratplldliktaltphppqkqaygvtlptsvlfiagh
dtnlanlggalelnwtlpgqpdntppggelvferwrrlsdnsqwiqvslvfqtlqqmrdk
tplslntppgevkltlagceernaqgmcslagftqivnearipacsl

Sequence, based on observed residues (ATOM records): (download)

>d1dklb_ c.60.1.2 (B:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Escherichia coli [TaxId: 562]}
pelklesvvivsrhgvraptkatqlmqdvtpdawptwpvklgwltprggeliaylghyqr
qrlvadgllakkgcpqsgqvaiiadvdertrktgeafaaglapdcaitvhtqadtsspdp
lfnplktgvcqldnanvtdailsraggsiadftghrqtafrelervlnfpqsnlclkrsc
sltqalpselkvsadnvsltgavslasmlteifllqqaqgmpepgwgritdshqwntlls
lhnaqfyllqrtpevarsratplldliktaltphppqkqaygvtlptsvlfiaghdtnla
nlggalelnwtlpgqpdntppggelvferwrrlsdnsqwiqvslvfqtlqqmrdktplsl
ntppgevkltlagceernaqgmcslagftqivnearipacsl

SCOPe Domain Coordinates for d1dklb_:

Click to download the PDB-style file with coordinates for d1dklb_.
(The format of our PDB-style files is described here.)

Timeline for d1dklb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dkla_