Lineage for d1dkla_ (1dkl A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25777Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
  4. 25778Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 25819Family c.60.1.3: Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) [53262] (1 protein)
  6. 25820Protein Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) [53263] (3 species)
  7. 25826Species Escherichia coli [TaxId:562] [53266] (6 PDB entries)
  8. 25827Domain d1dkla_: 1dkl A: [33996]

Details for d1dkla_

PDB Entry: 1dkl (more details), 2.3 Å

PDB Description: crystal structure of escherichia coli phytase at ph 4.5 (no ligand bound)

SCOP Domain Sequences for d1dkla_:

Sequence, based on SEQRES records: (download)

>d1dkla_ c.60.1.3 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Escherichia coli}
sepelklesvvivsrhgvraptkatqlmqdvtpdawptwpvklgwltprggeliaylghy
qrqrlvadgllakkgcpqsgqvaiiadvdertrktgeafaaglapdcaitvhtqadtssp
dplfnplktgvcqldnanvtdailsraggsiadftghrqtafrelervlnfpqsnlclkr
ekqdescsltqalpselkvsadnvsltgavslasmlteifllqqaqgmpepgwgritdsh
qwntllslhnaqfyllqrtpevarsratplldliktaltphppqkqaygvtlptsvlfia
ghdtnlanlggalelnwtlpgqpdntppggelvferwrrlsdnsqwiqvslvfqtlqqmr
dktplslntppgevkltlagceernaqgmcslagftqivnearipacsl

Sequence, based on observed residues (ATOM records): (download)

>d1dkla_ c.60.1.3 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Escherichia coli}
sepelklesvvivsrhgvraptkatqlmqdvtpdawptwpvklgwltprggeliaylghy
qrqrlvadgllakkgcpqsgqvaiiadvdertrktgeafaaglapdcaitvhtqadtssp
dplfnplktgvcqldnanvtdailsraggsiadftghrqtafrelervlnfpqsnlclkr
scsltqalpselkvsadnvsltgavslasmlteifllqqaqgmpepgwgritdshqwntl
lslhnaqfyllqrtpevarsratplldliktaltphppqkqaygvtlptsvlfiaghdtn
lanlggalelnwtlpgqpdntppggelvferwrrlsdnsqwiqvslvfqtlqqmrdktpl
slntppgevkltlagceernaqgmcslagftqivnearipacsl

SCOP Domain Coordinates for d1dkla_:

Click to download the PDB-style file with coordinates for d1dkla_.
(The format of our PDB-style files is described here.)

Timeline for d1dkla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dklb_