Lineage for d6aomb_ (6aom B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2579778Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2579779Protein HSP90 [55876] (3 species)
  7. 2579821Species Dog (Canis familiaris) [TaxId:9615] [103225] (35 PDB entries)
    Uniprot P41148 76-285; Endoplasmin, GRP94
  8. 2579880Domain d6aomb_: 6aom B: [339958]
    automated match to d2exla_
    complexed with gol, p33, peg, vc5

Details for d6aomb_

PDB Entry: 6aom (more details), 2.87 Å

PDB Description: structure of molecular chaperone grp94 bound to selective inhibitor methyl 2-[2-(2-benzylphenyl)ethyl]-3-chloro-4,6-dihydroxybenzoate
PDB Compounds: (B:) Endoplasmin

SCOPe Domain Sequences for d6aomb_:

Sequence, based on SEQRES records: (download)

>d6aomb_ d.122.1.1 (B:) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
ekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneelt
vkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqstselig
qfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlke
easdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn

Sequence, based on observed residues (ATOM records): (download)

>d6aomb_ d.122.1.1 (B:) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
ekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneelt
vkikcdkeknllhvtdtgvgmtreelvknlgtitseflnkmtestseligqfgvgfysaf
lvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlkeeasdyleldt
iknlvkkysqfinfpiyvwssktktvwdwelmn

SCOPe Domain Coordinates for d6aomb_:

Click to download the PDB-style file with coordinates for d6aomb_.
(The format of our PDB-style files is described here.)

Timeline for d6aomb_: