Lineage for d5vkkb2 (5vkk B:107-215)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2361929Domain d5vkkb2: 5vkk B:107-215 [339937]
    Other proteins in same PDB: d5vkkb1, d5vkkl1
    automated match to d1dn0a2

Details for d5vkkb2

PDB Entry: 5vkk (more details), 2.01 Å

PDB Description: crystal structure of fab fragment of anti-cd22 epratuzumab
PDB Compounds: (B:) Epratuzumab Fab Light Chain

SCOPe Domain Sequences for d5vkkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vkkb2 b.1.1.2 (B:107-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d5vkkb2:

Click to download the PDB-style file with coordinates for d5vkkb2.
(The format of our PDB-style files is described here.)

Timeline for d5vkkb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vkkb1