SCOPe 2.06: Domain d5x17b_: 5x17 B:

Lineage for d5x17b_ (5x17 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Casein kinase-1, CK1 [56139] (4 species)
   OPK group; CKI subfamily; serine/threonine kinase

7. Species Mouse (Mus musculus) [TaxId:10090] [197326] (2 PDB entries)

8. Domain d5x17b_: 5x17 B: [339931]
   automated match to d1ckja_
   complexed with adp, so4

Details for d5x17b_

PDB Entry: 5x17, 2 Å

PDB Description: crystal structure of murine ck1d in complex with adp

PDB Compounds: (B:) Casein kinase I isoform delta

SCOPe Domain Sequences for d5x17b_:

Sequence; same for both SEQRES and ATOM records:

>d5x17b_ d.144.1.7 (B:) Casein kinase-1, CK1 {Mouse (Mus musculus) [TaxId: 10090]}
rvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqggv
giptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihskn
fihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasin
thlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckg
ypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnm

Timeline for d5x17b_:

• d5x17b_ is new in SCOPe 2.06-stable
  
• d5x17b_ appears in SCOPe 2.07
  
• d5x17b_ appears in the current release, SCOPe 2.08