Lineage for d1ihpa_ (1ihp A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2127984Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2127985Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2128137Family c.60.1.2: Histidine acid phosphatase [53258] (4 protein domains)
  6. 2128142Protein Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) [53263] (4 species)
  7. 2128143Species Aspergillus ficuum [TaxId:5058] [53264] (1 PDB entry)
  8. 2128144Domain d1ihpa_: 1ihp A: [33993]
    complexed with so4

Details for d1ihpa_

PDB Entry: 1ihp (more details), 2.5 Å

PDB Description: structure of phosphomonoesterase
PDB Compounds: (A:) phytase

SCOPe Domain Sequences for d1ihpa_:

Sequence, based on SEQRES records: (download)

>d1ihpa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus ficuum [TaxId: 5058]}
scdtvdqgyqcfsetshlwgqyapffslanesvispevpagcrvtfaqvlsrhgaryptd
skgkkysalieeiqqnattfdgkyaflktynyslgaddltpfgeqelvnsgikfyqryes
ltrnivpfirssgssrviasgkkfiegfqstklkdpraqpgqsspkidvviseasssnnt
ldpgtctvfedseladtveanftatfvpsirqrlendlsgvtltdtevtylmdmcsfdti
ststvdtklspfcdlfthdewinydylqslkkyyghgagnplgptqgvgyaneliarlth
spvhddtssnhtldsspatfplnstlyadfshdngiisilfalglyngtkplstttveni
tqtdgfssawtvpfasrlyvemmqcqaeqeplvrvlvndrvvplhgcpvdalgrctrdsf
vrglsfarsggdwaecfa

Sequence, based on observed residues (ATOM records): (download)

>d1ihpa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus ficuum [TaxId: 5058]}
scdtvdqgyqcfsetshlwgqyapffslanesvispevpagcrvtfaqvlsrhgaryptd
skgkkysalieeiqqnattfdgkyaflktynyslgaddltpfgeqelvnsgikfyqryes
ltrnivpfirssgssrviasgkkfiegfqstklkdpraqpgqsspkidvviseasssnnt
ldpgtctvfedseladtveanftatfvpsirqrlendlsgvtltdtevtylmdmcsfdti
sttklspfcdlfthdewinydylqslkkyyghgagnplgptqgvgyaneliarlthspvh
ddtssnhtldsspatfplnstlyadfshdngiisilfalglyngtkplstttvenitqtd
gfssawtvpfasrlyvemmqcqaeqeplvrvlvndrvvplhgcpvdalgrctrdsfvrgl
sfarsggdwaecfa

SCOPe Domain Coordinates for d1ihpa_:

Click to download the PDB-style file with coordinates for d1ihpa_.
(The format of our PDB-style files is described here.)

Timeline for d1ihpa_: