Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Human (Homo sapiens), HLA-CW3 [TaxId:9606] [54477] (2 PDB entries) |
Domain d5w1wp1: 5w1w P:2-181 [339922] Other proteins in same PDB: d5w1wa2, d5w1wb1, d5w1wb2, d5w1wd1, d5w1wd2, d5w1we1, d5w1we2, d5w1wf2, d5w1wg1, d5w1wg2, d5w1wi1, d5w1wi2, d5w1wj1, d5w1wj2, d5w1wk2, d5w1wl1, d5w1wl2, d5w1wn1, d5w1wn2, d5w1wo1, d5w1wo2, d5w1wp2, d5w1wq1, d5w1wq2, d5w1ws1, d5w1ws2, d5w1wt1, d5w1wt2 automated match to d1efxa2 |
PDB Entry: 5w1w (more details), 3.1 Å
SCOPe Domain Sequences for d5w1wp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w1wp1 d.19.1.1 (P:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-CW3 [TaxId: 9606]} shslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseywd retrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdrrflrgyeqfaydgk dyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketllh
Timeline for d5w1wp1:
View in 3D Domains from other chains: (mouse over for more information) d5w1wa1, d5w1wa2, d5w1wb1, d5w1wb2, d5w1wd1, d5w1wd2, d5w1we1, d5w1we2, d5w1wf1, d5w1wf2, d5w1wg1, d5w1wg2, d5w1wi1, d5w1wi2, d5w1wj1, d5w1wj2, d5w1wk1, d5w1wk2, d5w1wl1, d5w1wl2, d5w1wn1, d5w1wn2, d5w1wo1, d5w1wo2, d5w1wq1, d5w1wq2, d5w1ws1, d5w1ws2, d5w1wt1, d5w1wt2 |