SCOPe 2.05: Domain d1cvid_: 1cvi D:

Lineage for d1cvid_ (1cvi D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.2: Histidine acid phosphatase [53258] (4 proteins)

6. Protein Prostatic acid phosphatase [53259] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53261] (4 PDB entries)

8. Domain d1cvid_: 1cvi D: [33992]
   complexed with gly, nag

Details for d1cvid_

PDB Entry: 1cvi, 3.2 Å

PDB Description: crystal structure of human prostatic acid phosphatase

PDB Compounds: (D:) prostatic acid phosphatase

SCOPe Domain Sequences for d1cvid_:

Sequence; same for both SEQRES and ATOM records:

>d1cvid_ c.60.1.2 (D:) Prostatic acid phosphatase {Human (Homo sapiens) [TaxId: 9606]}
kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt

Timeline for d1cvid_:

• d1cvid_ first appeared (with stable ids) in SCOP 1.55
  
• d1cvid_ appears in SCOPe 2.04
  
• d1cvid_ appears in SCOPe 2.06
  
• d1cvid_ appears in the current release, SCOPe 2.08