![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
![]() | Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) ![]() |
![]() | Family c.60.1.2: Histidine acid phosphatase [53258] (4 proteins) |
![]() | Protein Prostatic acid phosphatase [53259] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53261] (4 PDB entries) |
![]() | Domain d1cvid_: 1cvi D: [33992] complexed with gly, nag |
PDB Entry: 1cvi (more details), 3.2 Å
SCOPe Domain Sequences for d1cvid_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cvid_ c.60.1.2 (D:) Prostatic acid phosphatase {Human (Homo sapiens) [TaxId: 9606]} kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt
Timeline for d1cvid_: