SCOPe 2.08: Domain d5omza_: 5omz A:

Lineage for d5omza_ (5omz A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)

6. Protein automated matches [190183] (10 species)
   not a true protein

7. Species Zika virus (strain mr 766) [TaxId:64320] [339905] (1 PDB entry)

8. Domain d5omza_: 5omz A: [339906]
   automated match to d1s6na_

Details for d5omza_

PDB Entry: 5omz

PDB Description: solution structure of domain iii (diii)of zika virus envelope protein

PDB Compounds: (A:) envelope protein

SCOPe Domain Sequences for d5omza_:

Sequence; same for both SEQRES and ATOM records:

>d5omza_ b.1.18.4 (A:) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
mdklrlkgvsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltp
vgrlitanpvitestenskmmleldppfgdsyivigvgekkithhwhrsgstigk

Timeline for d5omza_:

• d5omza_ first appeared in SCOPe 2.06
  
• d5omza_ appears in SCOPe 2.07