Lineage for d1cvib_ (1cvi B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) 
Family c.60.1.2: Acid phosphatase [53258] (1 protein) Protein Acid phosphatase [53259] (2 species) Species Human (Homo sapiens) [TaxId:9606] [53261] (2 PDB entries) 
Domain d1cvib_: 1cvi B: [33990]
Details for d1cvib_
PDB Entry: 1cvi (more details), 3.2 Å
PDB Description: crystal structure of human prostatic acid phosphatase
SCOP Domain Sequences for d1cvib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cvib_ c.60.1.2 (B:) Acid phosphatase {Human (Homo sapiens)}
kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt
SCOP Domain Coordinates for d1cvib_:
Click to download the PDB-style file with coordinates for d1cvib_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cvib_:
- d1cvib_ appears in SCOP 1.57
- d1cvib_ appears in the current release, SCOPe 2.08
View in 3D
