Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (51 species) not a true protein |
Species Photorhabdus luminescens [TaxId:243265] [339829] (2 PDB entries) |
Domain d5ofxe_: 5ofx E: [339893] automated match to d4ywaa_ complexed with ca, fru, gla, glc |
PDB Entry: 5ofx (more details), 1.75 Å
SCOPe Domain Sequences for d5ofxe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ofxe_ b.18.1.0 (E:) automated matches {Photorhabdus luminescens [TaxId: 243265]} sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl k
Timeline for d5ofxe_: