Lineage for d1cvia_ (1cvi A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890965Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2890966Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2891136Family c.60.1.2: Histidine acid phosphatase [53258] (4 proteins)
  6. 2891168Protein Prostatic acid phosphatase [53259] (2 species)
  7. 2891169Species Human (Homo sapiens) [TaxId:9606] [53261] (4 PDB entries)
  8. 2891182Domain d1cvia_: 1cvi A: [33989]
    complexed with gly, nag

Details for d1cvia_

PDB Entry: 1cvi (more details), 3.2 Å

PDB Description: crystal structure of human prostatic acid phosphatase
PDB Compounds: (A:) prostatic acid phosphatase

SCOPe Domain Sequences for d1cvia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cvia_ c.60.1.2 (A:) Prostatic acid phosphatase {Human (Homo sapiens) [TaxId: 9606]}
kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt

SCOPe Domain Coordinates for d1cvia_:

Click to download the PDB-style file with coordinates for d1cvia_.
(The format of our PDB-style files is described here.)

Timeline for d1cvia_: