Lineage for d5x18b_ (5x18 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2220941Protein automated matches [190091] (17 species)
    not a true protein
  7. 2222041Species Saccharomyces cerevisiae [TaxId:559292] [339888] (1 PDB entry)
  8. 2222043Domain d5x18b_: 5x18 B: [339889]
    automated match to d5fqdf_
    complexed with gol, mla

Details for d5x18b_

PDB Entry: 5x18 (more details), 1.8 Å

PDB Description: crystal structure of casein kinase i homolog 1
PDB Compounds: (B:) Casein kinase I homolog 1

SCOPe Domain Sequences for d5x18b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x18b_ d.144.1.7 (B:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
stivglhykigkkigegsfgvlfegtnmingvpvaikfeprkteapqlrdeyktykilng
tpnipyayyfgqeglhnilvidllgpsledlfdwcgrkfsvktvvqvavqmitliedlha
hdliyrdikpdnfligrpgqpdannihlidfgmakqyrdpktkqhipyrekkslsgtary
msinthlgreqsrrddmealghvffyflrghlpwqglkapnnkqkyekigekkrstnvyd
laqglpvqfgryleivrslsfeecpdyegyrklllsvlddlgetadgqydwmkl

SCOPe Domain Coordinates for d5x18b_:

Click to download the PDB-style file with coordinates for d5x18b_.
(The format of our PDB-style files is described here.)

Timeline for d5x18b_: