Lineage for d5wqob_ (5wqo B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (247 species)
    not a true protein
  7. 2431988Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196452] (28 PDB entries)
  8. 2432008Domain d5wqob_: 5wqo B: [339880]
    Other proteins in same PDB: d5wqoa2
    automated match to d3wxbb_
    complexed with edo, na, nap

Details for d5wqob_

PDB Entry: 5wqo (more details), 1.78 Å

PDB Description: crystal structure of a carbonyl reductase from pseudomonas aeruginosa pao1 in complex with nadp (condition i)
PDB Compounds: (B:) Probable dehydrogenase

SCOPe Domain Sequences for d5wqob_:

Sequence, based on SEQRES records: (download)

>d5wqob_ c.2.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mhnvlivgasrgiglgladaflqrgaqvfavarrpqgspglqalaeragerlqavtgdln
qhdcaerigemlgerridrlivnagiygpqqqdvaeidaeqtaqlfltnaiaplrlaral
sgrvsrggvvafmssqmaslalglsatmplygaskaalnslvrswegefeelpfsllllh
pgwvrtemggdsaplsveesaaglvaavedaagvnacrfvdyrnqplpw

Sequence, based on observed residues (ATOM records): (download)

>d5wqob_ c.2.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mhnvlivgasrgiglgladaflqrgaqvfavarrpqgspglqalaeragerlqavtgdln
qhdcaerigemlgerridrlivnagiygpqqqdvaeidaeqtaqlfltnaiaplrlaral
sgrvsrggvvafmssqmaslalglsatmplygaskaalnslvrswegefeelpfsllllh
pgwvrlsveesaaglvaavedaagvnacrfvdyrnqplpw

SCOPe Domain Coordinates for d5wqob_:

Click to download the PDB-style file with coordinates for d5wqob_.
(The format of our PDB-style files is described here.)

Timeline for d5wqob_: