![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (243 species) not a true protein |
![]() | Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196452] (27 PDB entries) |
![]() | Domain d5wqnc_: 5wqn C: [339879] automated match to d3wxbb_ |
PDB Entry: 5wqn (more details), 2 Å
SCOPe Domain Sequences for d5wqnc_:
Sequence, based on SEQRES records: (download)
>d5wqnc_ c.2.1.0 (C:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} mhnvlivgasrgiglgladaflqrgaqvfavarrpqgspglqalaeragerlqavtgdln qhdcaerigemlgerridrlivnagiygpqqqdvaeidaeqtaqlfltnaiaplrlaral sgrvsrggvvafmssqmaslalglsatmplygaskaalnslvrswegefeelpfsllllh pgwvrtemggdsaplsveesaaglvaavedaagvnacrfvdyrnqplpw
>d5wqnc_ c.2.1.0 (C:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} mhnvlivgasrgiglgladaflqrgaqvfavarrpqgspglqalaeragerlqavtgdln qhdcaerigemlgerridrlivnagiygpqqqdvaeidaeqtaqlfltnaiaplrlaral sgrvsrggvvafmssqmaslalglsatmplygaskaalnslvrswegefeelpfsllllh pgwvaplsveesaaglvaavedaagvnacrfvdyrnqplpw
Timeline for d5wqnc_: