Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.1: Legume lectins [49900] (5 proteins) |
Protein automated matches [190035] (28 species) not a true protein |
Species Platypodium elegans [TaxId:115002] [189870] (3 PDB entries) |
Domain d5u38a_: 5u38 A: [339872] automated match to d3zvxa_ complexed with ca, mn, nag |
PDB Entry: 5u38 (more details), 1.6 Å
SCOPe Domain Sequences for d5u38a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u38a_ b.29.1.1 (A:) automated matches {Platypodium elegans [TaxId: 115002]} tdslsfsfinfdrdernlifqgdahtsrnnilqltrtdsngapvrstvgrilhsaqvrlw ekstnrvanfqtqfsfflssplsnpadgiaffiappdttipsgsaggllglfnprtalne sanqvlavefdtffaqnsntwdpnyqhigidvnsirsskvvrwerregktlnvlvtynps trtidvvatypdgqryqlshvvdlttilpewvrvgfsaasgeqfqthnleswsftstll
Timeline for d5u38a_: