Lineage for d5tkca_ (5tkc A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2420459Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2421872Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2421873Protein automated matches [190115] (76 species)
    not a true protein
  7. 2422468Species Toxoplasma gondii [TaxId:5811] [339857] (6 PDB entries)
  8. 2422470Domain d5tkca_: 5tkc A: [339870]
    automated match to d3kx6a_
    complexed with 13p, g3h, gol

Details for d5tkca_

PDB Entry: 5tkc (more details), 1.78 Å

PDB Description: crystal structure of fbp aldolase from toxoplasma gondii, ternary complex
PDB Compounds: (A:) Fructose-bisphosphate aldolase

SCOPe Domain Sequences for d5tkca_:

Sequence, based on SEQRES records: (download)

>d5tkca_ c.1.10.0 (A:) automated matches {Toxoplasma gondii [TaxId: 5811]}
sgyglpisqevakelaenarkiaapgkgilaadestgtikkrfdsigventeanrafyrd
llfstkglgqyisgailfeetlyqkspsgvpmvdllkaegiipgikvdkgletlpltdde
katmgldglserckkyyeagarfakwravlsidpakgkptnlsitevahglaryaaicqa
nrlvpivepeiltdgshditvcaevtervlaavfkalndhhvllegallkpnmvthgsdc
pkpasheeiafytvrslkrtvppalpgvmflsggqseedaslnlnemnkmgphpfqlsfs
ygralqasclkawkgvpenkakaqqvlmerarangeaqlgkygggaggalaasslfekry
vy

Sequence, based on observed residues (ATOM records): (download)

>d5tkca_ c.1.10.0 (A:) automated matches {Toxoplasma gondii [TaxId: 5811]}
sgyglpisqevakelaenarkiaapgkgilaadestgtikkrfdsigventeanrafyrd
llfstkglgqyisgailfeetlyqkspsgvpmvdllkaegiipgikvdkgletlpltdde
katmgldglserckkyyeagarfakwravlsidpakgkptnlsitevahglaryaaicqa
nrlvpivepeiltdgshditvcaevtervlaavfkalndhhvllegallkpnmvthgsdc
pkpasheeiafytvrslkrtvppalpgvmflsggqseedaslnlnemnkmgphpfqlsfs
ygralqasclkawkgvpenkakaqqvlmerarangeaqlgkygggyvy

SCOPe Domain Coordinates for d5tkca_:

Click to download the PDB-style file with coordinates for d5tkca_.
(The format of our PDB-style files is described here.)

Timeline for d5tkca_: