![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (51 species) not a true protein |
![]() | Species Photorhabdus luminescens [TaxId:243265] [339829] (2 PDB entries) |
![]() | Domain d5ofxc_: 5ofx C: [339865] automated match to d4ywaa_ complexed with ca, fru, gla, glc |
PDB Entry: 5ofx (more details), 1.75 Å
SCOPe Domain Sequences for d5ofxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ofxc_ b.18.1.0 (C:) automated matches {Photorhabdus luminescens [TaxId: 243265]} sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl k
Timeline for d5ofxc_: