Lineage for d5oduf_ (5odu F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775355Species Photorhabdus luminescens [TaxId:29488] [339816] (2 PDB entries)
  8. 2775361Domain d5oduf_: 5odu F: [339862]
    automated match to d4ywaa_
    complexed with amg, ca

Details for d5oduf_

PDB Entry: 5odu (more details), 1.56 Å

PDB Description: plla lectin, monosaccharide complex
PDB Compounds: (F:) PllA

SCOPe Domain Sequences for d5oduf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oduf_ b.18.1.0 (F:) automated matches {Photorhabdus luminescens [TaxId: 29488]}
sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
k

SCOPe Domain Coordinates for d5oduf_:

Click to download the PDB-style file with coordinates for d5oduf_.
(The format of our PDB-style files is described here.)

Timeline for d5oduf_: