Lineage for d5tkla_ (5tkl A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2420459Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2421872Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2421873Protein automated matches [190115] (76 species)
    not a true protein
  7. 2422468Species Toxoplasma gondii [TaxId:5811] [339857] (6 PDB entries)
  8. 2422469Domain d5tkla_: 5tkl A: [339861]
    automated match to d3kx6a_
    complexed with 13p, g3h, p6f

Details for d5tkla_

PDB Entry: 5tkl (more details), 1.75 Å

PDB Description: crystal structure of fbp aldolase from toxoplasma gondii, condensation intermediate
PDB Compounds: (A:) Fructose-bisphosphate aldolase

SCOPe Domain Sequences for d5tkla_:

Sequence, based on SEQRES records: (download)

>d5tkla_ c.1.10.0 (A:) automated matches {Toxoplasma gondii [TaxId: 5811]}
msgyglpisqevakelaenarkiaapgkgilaadestgtikkrfdsigventeanrafyr
dllfstkglgqyisgailfeetlyqkspsgvpmvdllkaegiipgikvdkgletlpltdd
ekatmgldglserckkyyeagarfakwravlsidpakgkptnlsitevahglaryaaicq
anrlvpivepeiltdgshditvcaevtervlaavfkalndhhvllegallkpnmvthgsd
cpkpasheeiafytvrslkrtvppalpgvmflsggqseedaslnlnemnkmgphpfqlsf
sygralqasclkawkgvpenkakaqqvlmerarangeaqlgkygggaggalaasslfekr
yvy

Sequence, based on observed residues (ATOM records): (download)

>d5tkla_ c.1.10.0 (A:) automated matches {Toxoplasma gondii [TaxId: 5811]}
msgyglpisqevakelaenarkiaapgkgilaadestgtikkrfdsigventeanrafyr
dllfstkglgqyisgailfeetlyqkspsgvpmvdllkaegiipgikvdkgletlpltdd
ekatmgldglserckkyyeagarfakwravlsidpakgkptnlsitevahglaryaaicq
anrlvpivepeiltdgshditvcaevtervlaavfkalndhhvllegallkpnmvthgsd
cpkpasheeiafytvrslkrtvppalpgvmflsggqseedaslnlnemnkmgphpfqlsf
sygralqasclkawkgvpenkakaqqvlmerarangeaqlgkygggayvy

SCOPe Domain Coordinates for d5tkla_:

Click to download the PDB-style file with coordinates for d5tkla_.
(The format of our PDB-style files is described here.)

Timeline for d5tkla_: