Lineage for d5ofka1 (5ofk A:1-336)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (97 species)
    not a true protein
  7. 2418927Species Caldicellulosiruptor bescii [TaxId:521460] [256973] (6 PDB entries)
  8. 2418928Domain d5ofka1: 5ofk A:1-336 [339844]
    Other proteins in same PDB: d5ofka2
    automated match to d4w8la_
    complexed with mpd, pin, so4, xyp

Details for d5ofka1

PDB Entry: 5ofk (more details), 1.16 Å

PDB Description: crystal structure of cbxyn10c variant e140q/e248q complexed with xyloheptaose
PDB Compounds: (A:) Glycoside hydrolase family 48

SCOPe Domain Sequences for d5ofka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ofka1 c.1.8.0 (A:1-336) automated matches {Caldicellulosiruptor bescii [TaxId: 521460]}
pdwnipslyesykndfrigvaipakclsndtdrrmvlkhfnsitaenemkpesllagqts
tglnyrfstadtfvdfantnnigirghtlvwhsqtpdwffkdssgqrltkdallarlkqy
iydvvgrykgkvyawdvvnqaidenqsdgyrrstwyeicgpeyiekafiwaheadpnakl
fyndynteiskkrdfiynmvknlkskgipihgigmqchinvnwpsvseiensiklfssip
gieihitqldmslynygssenystppqdllqkqaqkykelftmlkkytnvvkcvtfwglk
ddyswlrsfngkndwplllfedysakpaywavieas

SCOPe Domain Coordinates for d5ofka1:

Click to download the PDB-style file with coordinates for d5ofka1.
(The format of our PDB-style files is described here.)

Timeline for d5ofka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ofka2