Lineage for d1rpt__ (1rpt -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) 
Family c.60.1.2: Acid phosphatase [53258] (1 protein) Protein Acid phosphatase [53259] (2 species) 
Species Rat (Rattus norvegicus) [TaxId:10116] [53260] (2 PDB entries) 
Domain d1rpt__: 1rpt - [33984]
Details for d1rpt__
PDB Entry: 1rpt (more details), 3 Å
PDB Description: crystal structures of rat acid phosphatase complexed with the transitions state analogs vanadate and molybdate: implications for the reaction mechanism
SCOP Domain Sequences for d1rpt__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rpt__ c.60.1.2 (-) Acid phosphatase {Rat (Rattus norvegicus)}
kelkfvtlvfrhgdrgpietfpndpikesswpqgfgqltkwgmgqhyelgsyirrrygrf
lnnsykhdqvyirstdvdrtlmsamtnlaalfppegnsiwnprllwqpipvhtvslsedr
llylpfrdcprfqelksetlkseeflkrlqpyksfidtlpslsgfedqdlfeiwsrlydp
lycesvhnftlptwatedamtklkelselsllslygihkqkeksrlqggvlvneilknmk
latqpqkarklimysahdttvsglqmaldvyngllppyaschimelyqdngghfvemyyr
netqnepypltlpgcthscplekfaelldpvipqdwatecmg
SCOP Domain Coordinates for d1rpt__:
Click to download the PDB-style file with coordinates for d1rpt__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rpt__:
- d1rpt__ appears in SCOP 1.57
- d1rpt__ appears in the current release, SCOPe 2.08, called d1rpta_
View in 3D