Lineage for d1rpta_ (1rpt A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2127984Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2127985Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2128137Family c.60.1.2: Histidine acid phosphatase [53258] (4 protein domains)
  6. 2128166Protein Prostatic acid phosphatase [53259] (2 species)
  7. 2128184Species Norway rat (Rattus norvegicus) [TaxId:10116] [53260] (2 PDB entries)
  8. 2128185Domain d1rpta_: 1rpt A: [33984]
    complexed with nag, vo4

Details for d1rpta_

PDB Entry: 1rpt (more details), 3 Å

PDB Description: crystal structures of rat acid phosphatase complexed with the transitions state analogs vanadate and molybdate: implications for the reaction mechanism
PDB Compounds: (A:) prostatic acid phosphatase

SCOPe Domain Sequences for d1rpta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rpta_ c.60.1.2 (A:) Prostatic acid phosphatase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kelkfvtlvfrhgdrgpietfpndpikesswpqgfgqltkwgmgqhyelgsyirrrygrf
lnnsykhdqvyirstdvdrtlmsamtnlaalfppegnsiwnprllwqpipvhtvslsedr
llylpfrdcprfqelksetlkseeflkrlqpyksfidtlpslsgfedqdlfeiwsrlydp
lycesvhnftlptwatedamtklkelselsllslygihkqkeksrlqggvlvneilknmk
latqpqkarklimysahdttvsglqmaldvyngllppyaschimelyqdngghfvemyyr
netqnepypltlpgcthscplekfaelldpvipqdwatecmg

SCOPe Domain Coordinates for d1rpta_:

Click to download the PDB-style file with coordinates for d1rpta_.
(The format of our PDB-style files is described here.)

Timeline for d1rpta_: