Lineage for d5ofzb_ (5ofz B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775342Species Photorhabdus luminescens [TaxId:243265] [339829] (2 PDB entries)
  8. 2775352Domain d5ofzb_: 5ofz B: [339839]
    automated match to d4ywaa_

Details for d5ofzb_

PDB Entry: 5ofz (more details), 1.75 Å

PDB Description: plla lectin, apo
PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d5ofzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ofzb_ b.18.1.0 (B:) automated matches {Photorhabdus luminescens [TaxId: 243265]}
dwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssia
tlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysplk

SCOPe Domain Coordinates for d5ofzb_:

Click to download the PDB-style file with coordinates for d5ofzb_.
(The format of our PDB-style files is described here.)

Timeline for d5ofzb_: