![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (51 species) not a true protein |
![]() | Species Photorhabdus luminescens [TaxId:29488] [339816] (2 PDB entries) |
![]() | Domain d5odub_: 5odu B: [339835] automated match to d4ywaa_ complexed with amg, ca |
PDB Entry: 5odu (more details), 1.56 Å
SCOPe Domain Sequences for d5odub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5odub_ b.18.1.0 (B:) automated matches {Photorhabdus luminescens [TaxId: 29488]} sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl k
Timeline for d5odub_: