| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) ![]() |
| Family d.50.1.0: automated matches [254259] (1 protein) not a true family |
| Protein automated matches [254599] (1 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255442] (2 PDB entries) |
| Domain d5npaa_: 5npa A: [339834] automated match to d1di2a_ |
PDB Entry: 5npa (more details)
SCOPe Domain Sequences for d5npaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5npaa_ d.50.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
igwlqemcmqrrwpppsyetetevglpherlftiacsilnyremgkgkskkiakrlaahr
mwmrlqe
Timeline for d5npaa_: