Lineage for d5npaa_ (5npa A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946839Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2946840Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2947034Family d.50.1.0: automated matches [254259] (1 protein)
    not a true family
  6. 2947035Protein automated matches [254599] (2 species)
    not a true protein
  7. 2947036Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255442] (2 PDB entries)
  8. 2947037Domain d5npaa_: 5npa A: [339834]
    automated match to d1di2a_

Details for d5npaa_

PDB Entry: 5npa (more details)

PDB Description: solution structure of drosophila melanogaster loquacious dsrbd2
PDB Compounds: (A:) Loquacious

SCOPe Domain Sequences for d5npaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5npaa_ d.50.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
igwlqemcmqrrwpppsyetetevglpherlftiacsilnyremgkgkskkiakrlaahr
mwmrlqe

SCOPe Domain Coordinates for d5npaa_:

Click to download the PDB-style file with coordinates for d5npaa_.
(The format of our PDB-style files is described here.)

Timeline for d5npaa_: