SCOPe 2.08: Domain d5o04f1: 5o04 F:6-111

Lineage for d5o04f1 (5o04 F:6-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)

8. Domain d5o04f1: 5o04 F:6-111 [339832]
   Other proteins in same PDB: d5o04a_, d5o04b_, d5o04c2, d5o04c3, d5o04d2, d5o04e2, d5o04f2
   automated match to d4ldeb_
   complexed with edo

Details for d5o04f1

PDB Entry: 5o04, 2.3 Å

PDB Description: gii.10 vietnam 026 norovirus protruding domain in complex with nanobody nano-26 and nano-85

PDB Compounds: (F:) Nanobody (VHH) Nano-26

SCOPe Domain Sequences for d5o04f1:

Sequence, based on SEQRES records:

>d5o04f1 b.1.1.1 (F:6-111) automated matches {Vicugna pacos [TaxId: 30538]}
esggglvqpggslrlsctapriiffmydvgwyrqapekqrelvaqinsdvstkyadsvkg
rftisrdnakrtvylqmndlkpedaavyycnvrrasadywgqgtqv

Sequence, based on observed residues (ATOM records):

>d5o04f1 b.1.1.1 (F:6-111) automated matches {Vicugna pacos [TaxId: 30538]}
esglvqpslrlsctapriiffmydvgwyrrelvaqinsdvstkyadsvkgrftisrdnak
rtvylqmndlkpedaavyycnvrrasadywgqgtqv

Timeline for d5o04f1:

• d5o04f1 first appeared in SCOPe 2.06, called d5o04f_
  
• d5o04f1 appears in SCOPe 2.07