SCOPe 2.05: Domain d1rpaa_: 1rpa A:

Lineage for d1rpaa_ (1rpa A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.2: Histidine acid phosphatase [53258] (4 proteins)

6. Protein Prostatic acid phosphatase [53259] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [53260] (2 PDB entries)

8. Domain d1rpaa_: 1rpa A: [33983]
   complexed with nag, tar

Details for d1rpaa_

PDB Entry: 1rpa, 3 Å

PDB Description: three-dimensional structure of rat acid phosphatase in complex with l(+) tartrate

PDB Compounds: (A:) prostatic acid phosphatase

SCOPe Domain Sequences for d1rpaa_:

Sequence; same for both SEQRES and ATOM records:

>d1rpaa_ c.60.1.2 (A:) Prostatic acid phosphatase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kelkfvtlvfrhgdrgpietfpndpikesswpqgfgqltkwgmgqhyelgsyirrrygrf
lnnsykhdqvyirstdvdrtlmsamtnlaalfppegnsiwnprllwqpipvhtvslsedr
llylpfrdcprfqelksetlkseeflkrlqpyksfidtlpslsgfedqdlfeiwsrlydp
lycesvhnftlptwatedamtklkelselsllslygihkqkeksrlqggvlvneilknmk
latqpqkarklimysahdttvsglqmaldvyngllppyaschimelyqdngghfvemyyr
netqnepypltlpgcthscplekfaelldpvipqdwatecmg

Timeline for d1rpaa_:

• d1rpaa_ first appeared (with stable ids) in SCOP 1.55, called d1rpa__
  
• d1rpaa_ appears in SCOPe 2.04
  
• d1rpaa_ appears in SCOPe 2.06
  
• d1rpaa_ appears in the current release, SCOPe 2.08