Lineage for d3pgm__ (3pgm -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) 
Family c.60.1.1: Phosphoglycerate mutase [53255] (1 protein) Protein Phosphoglycerate mutase [53256] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53257] (6 PDB entries) 
Domain d3pgm__: 3pgm - [33982]
Details for d3pgm__
PDB Entry: 3pgm (more details), 2.8 Å
PDB Description: the structure of yeast phosphoglycerate mutase at 0.28 nm resolution
SCOP Domain Sequences for d3pgm__:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pgm__ c.60.1.1 (-) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae)}
pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekgvnvlvdytsklsra
iqtanialekadrlwipvnrswrlnerhygdlqgkdkaqtlkkfgeekfntyrrsfdvpp
ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviaklvgktsmiaahg
nslrglvkhlegisdadiaklnippgtilvfeldenlkpskpsyyldpea
SCOP Domain Coordinates for d3pgm__:
Click to download the PDB-style file with coordinates for d3pgm__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3pgm__:
- d3pgm__ appears in SCOP 1.57
- d3pgm__ appears in the current release, SCOPe 2.08, called d3pgma_
View in 3D