| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (51 species) not a true protein |
| Species Photorhabdus luminescens [TaxId:29488] [339816] (2 PDB entries) |
| Domain d5ofif_: 5ofi F: [339817] automated match to d4ywaa_ complexed with 9tq, ca |
PDB Entry: 5ofi (more details), 2 Å
SCOPe Domain Sequences for d5ofif_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ofif_ b.18.1.0 (F:) automated matches {Photorhabdus luminescens [TaxId: 29488]}
sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
k
Timeline for d5ofif_: