![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries) |
![]() | Domain d5o04c1: 5o04 C:6-119 [339813] Other proteins in same PDB: d5o04a_, d5o04b_, d5o04c2, d5o04c3, d5o04d2, d5o04e2, d5o04f2 automated match to d4xt1c_ complexed with edo |
PDB Entry: 5o04 (more details), 2.3 Å
SCOPe Domain Sequences for d5o04c1:
Sequence, based on SEQRES records: (download)
>d5o04c1 b.1.1.1 (C:6-119) automated matches {Vicugna pacos [TaxId: 30538]} esggglvqpggslrlscaasgsifsiyamgwyrqapgkqrelvasissgggtnyadsvkg rftisgdnakntvylqmnslkpedtavyyckredysayappsgsrgrgtqvtvs
>d5o04c1 b.1.1.1 (C:6-119) automated matches {Vicugna pacos [TaxId: 30538]} esggglvqpggslrlscaasgsifsiyamgwyrqgkqrelvasissgggtnyadsvkgrf tisgdnakntvylqmnslkpedtavyyckredysayappsgsrgrgtqvtvs
Timeline for d5o04c1: