Lineage for d5o05d1 (5o05 D:6-118)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2348290Species Vicugna pacos [TaxId:30538] [189756] (42 PDB entries)
  8. 2348318Domain d5o05d1: 5o05 D:6-118 [339808]
    Other proteins in same PDB: d5o05c2, d5o05d2
    automated match to d4ldeb_
    complexed with edo

Details for d5o05d1

PDB Entry: 5o05 (more details), 2 Å

PDB Description: gii.10 vietnam 026 norovirus protruding domain in complex with nanobody nano-42
PDB Compounds: (D:) Nanobody (VHH) Nano-42

SCOPe Domain Sequences for d5o05d1:

Sequence, based on SEQRES records: (download)

>d5o05d1 b.1.1.1 (D:6-118) automated matches {Vicugna pacos [TaxId: 30538]}
esggglvqpggslrlscaasgsvsrtyvmgwyrqtpgnqrelvatitsvgstnyadslkg
rftisrenaentvylqmnslkpedtaiyyckyiryspihapldywgqgtqvtv

Sequence, based on observed residues (ATOM records): (download)

>d5o05d1 b.1.1.1 (D:6-118) automated matches {Vicugna pacos [TaxId: 30538]}
esggglvqpggslrlscaasgsvsrtyvmgwyrqtpgnqrelvatitsvgstnyadslkg
rftisrntvylqmnslkpedtaiyyckyiryspihapldywgqgtqvtv

SCOPe Domain Coordinates for d5o05d1:

Click to download the PDB-style file with coordinates for d5o05d1.
(The format of our PDB-style files is described here.)

Timeline for d5o05d1:

  • d5o05d1 first appeared in SCOPe 2.06, called d5o05d_

View in 3D
Domains from same chain:
(mouse over for more information)
d5o05d2