SCOPe 2.08: Domain d5o05d1: 5o05 D:6-118

Lineage for d5o05d1 (5o05 D:6-118)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)

8. Domain d5o05d1: 5o05 D:6-118 [339808]
   Other proteins in same PDB: d5o05a_, d5o05b_, d5o05c2, d5o05d2
   automated match to d4ldeb_
   complexed with edo

Details for d5o05d1

PDB Entry: 5o05, 2 Å

PDB Description: gii.10 vietnam 026 norovirus protruding domain in complex with nanobody nano-42

PDB Compounds: (D:) Nanobody (VHH) Nano-42

SCOPe Domain Sequences for d5o05d1:

Sequence, based on SEQRES records:

>d5o05d1 b.1.1.1 (D:6-118) automated matches {Vicugna pacos [TaxId: 30538]}
esggglvqpggslrlscaasgsvsrtyvmgwyrqtpgnqrelvatitsvgstnyadslkg
rftisrenaentvylqmnslkpedtaiyyckyiryspihapldywgqgtqvtv

Sequence, based on observed residues (ATOM records):

>d5o05d1 b.1.1.1 (D:6-118) automated matches {Vicugna pacos [TaxId: 30538]}
esggglvqpggslrlscaasgsvsrtyvmgwyrqtpgnqrelvatitsvgstnyadslkg
rftisrntvylqmnslkpedtaiyyckyiryspihapldywgqgtqvtv

Timeline for d5o05d1:

• d5o05d1 first appeared in SCOPe 2.06, called d5o05d_
  
• d5o05d1 appears in SCOPe 2.07