Lineage for d1bq3c_ (1bq3 C:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25777Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
  4. 25778Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 25779Family c.60.1.1: Phosphoglycerate mutase [53255] (1 protein)
  6. 25780Protein Phosphoglycerate mutase [53256] (1 species)
  7. 25781Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53257] (6 PDB entries)
  8. 25802Domain d1bq3c_: 1bq3 C: [33980]

Details for d1bq3c_

PDB Entry: 1bq3 (more details), 2.7 Å

PDB Description: saccharomyces cerevisiae phosphoglycerate mutase in complex with inositol hexakisphosphate

SCOP Domain Sequences for d1bq3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bq3c_ c.60.1.1 (C:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae)}
pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaa

SCOP Domain Coordinates for d1bq3c_:

Click to download the PDB-style file with coordinates for d1bq3c_.
(The format of our PDB-style files is described here.)

Timeline for d1bq3c_: